PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G211200.1.p
Common NameSb04g025660, SORBIDRAFT_04g025660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family CO-like
Protein Properties Length: 337aa    MW: 35353.2 Da    PI: 4.7975
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G211200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.94.1e-082461438
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38
                          r C+ +  ++++l+C++++ +lC+ C    H g    H 
  Sobic.004G211200.1.p 24 RPCDACAAEPARLHCREDGAFLCPGCDARAH-GagsrHA 61
                          68**************************999.4466675 PP

2zf-B_box22.91.8e-0763107341
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                            + C+ +e+ ++   C+ +   lC+ C   +H+       H++ p
  Sobic.004G211200.1.p  63 VWLCEVCEHAPAAVTCRADAAALCAACDADIHSAnplarrHERLP 107
                           679*****************************6688888898877 PP

3CCT70.25e-24258300143
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                           Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k+
  Sobic.004G211200.1.p 258 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKR 300
                           9****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.2E-52165IPR000315B-box-type zinc finger
PROSITE profilePS501199.842165IPR000315B-box-type zinc finger
PfamPF006433.0E-62461IPR000315B-box-type zinc finger
CDDcd000211.20E-62465No hitNo description
PROSITE profilePS5011910.42461108IPR000315B-box-type zinc finger
PfamPF006438.0E-663108IPR000315B-box-type zinc finger
SMARTSM003364.6E-966108IPR000315B-box-type zinc finger
PROSITE profilePS5101716.916258300IPR010402CCT domain
PfamPF062033.0E-18258300IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDTAVELELE QKPAVGYWSV VGARPCDACA AEPARLHCRE DGAFLCPGCD ARAHGAGSRH  60
ARVWLCEVCE HAPAAVTCRA DAAALCAACD ADIHSANPLA RRHERLPVAP FFGALADAPQ  120
PFPSPAFAAA AAAGGQAQGE AAAADNDDDD GSNEAEAASW LLAEPDNSHE DSAAATAADT  180
LFAESDAYLG VDLDFARCMD GVKAIGVPVA PPELDIAAGS FFYPEHSMNH SLSSSEVAVV  240
PDAQAAGVPA VVSRGKEREA RLMRYREKRK NRRFDKTIRY ASRKAYAETR PRIKGRFAKR  300
CSAEADDDAL EHDEGACFSP AGSAHAASDG VVPSFC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.102250.0ovary| panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9562390.0EU956239.1 Zea mays clone 1559496 CONSTANS-like protein CO5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452430.10.0hypothetical protein SORBIDRAFT_04g025660
TrEMBLC5XXA80.0C5XXA8_SORBI; Putative uncharacterized protein Sb04g025660
STRINGSb04g025660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.16e-39CONSTANS-like 3